PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4U31173.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YC
Protein Properties Length: 180aa    MW: 20378.8 Da    PI: 10.1581
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4U31173.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.72.9e-196861898
          NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                   ++++P arikki+++dedv +i+  +P l+ska elf+ +l  r++  + +   +tl+   ++++v+  ++fdfl +iv r
  Jcr4U31173.10  6 DTRFPAARIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYAITLKRGAKTLNSLHLKQCVQTFNVFDFLREIVSR 86
                   5789*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-26372IPR009072Histone-fold
SuperFamilySSF471131.08E-19488IPR009072Histone-fold
PfamPF008084.2E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQT DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YAITLKRGAK  60
TLNSLHLKQC VQTFNVFDFL REIVSRVPDL GGSDTTGDDR VVAKRRKVAD DEDTDSEEEL  120
NQSIMPYGFR VLNNVLFIRE AIGPLRRNPP VLAPRIAWRM ALSKRPYVNP GSFSTACIKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-24272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075998.15e-84PREDICTED: dr1-associated corepressor-like
TrEMBLA0A067KHP65e-84A0A067KHP6_JATCU; Uncharacterized protein
STRINGGLYMA02G44500.25e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-61nuclear factor Y, subunit C11